Penicillinase Repressor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Penicillinase Repressor
  Conformer 1
(PDB) 		1xsd (A)
  Conformer 2
(PDB) 		1sd4 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 70 0.79   7 - 78
2 44 0.57   79 - 124

Sequence


           ___________________________________________________________________________78___________________________________________ 
 1xsd(A) : TNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILN 
         :                                                                                                                          
 1sd4(A) : ***QVEIS-aEWDV-nIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIK-kTAKTFLNKLYGGD-kSLVLNFAKNEELNNKEIEELRDILN 
           ___________________________________________________________________________78___________________________________________ 

           _____                                                                                                                    
 1xsd(A) : DISKK                                                                                                                    
         :                                                                                                                          
 1sd4(A) : DISKK                                                                                                                    
           _____                                                                                                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.7
Translation
(A) 		0.1
Closure
(%) 		93.9
Bending Residues
( green ) 		  78 - 79
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download