Pol Polyprotein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Pol Polyprotein
  Conformer 1
(PDB) 		1f7o (A)
  Conformer 2
(PDB) 		1f7d (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 68 0.71   3 - 22   36 - 52   66 - 79   98 - 114
2 44 0.92   23 - 35   53 - 65   80 - 97

Sequence


           ____________________22___________35_______________52___________65____________79________________97_____________________   
 1f7o(A) : MIIEGDGILDKRSEDAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIGSKGLDVLGGVIDEGYRGEIGVIMINVSRKSITLMERQKIAQLIILPCKHEVLEQGKV**   
         :                                                                                                                          
 1f7d(A) : MIIEGDGILDKRSEDAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIGSKGLDVLGGVIDEGYRGEIGVIMINVSRKSITLMERQKIAQLIILPCKHEVLEQGKVVM   
           ____________________22___________35_______________52___________65____________79________________97_____________________   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.2
Translation
(A) 		0.6
Closure
(%) 		97.4
Bending Residues
( green ) 		  22 - 23
  35 - 36
  52 - 53
  65 - 69
  79 - 80
  97 - 98
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download