Probable Translation Initiation Factor 2 Alpha Subunit

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Probable Translation Initiation Factor 2 Alpha Subunit
  Conformer 1
(PDB) 		1yz6 (A)
  Conformer 2
(PDB) 		1yz7 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 90 1.14   174 - 263
2 81 0.74   93 - 173

Sequence


           ________________________________________________________________________________________________________________________ 
 1yz6(A) : AREYPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLKLAAEKLGKDFETAWRE 
         :                                                                                                                          
 1yz7(A) : **************************************************************************************KAKLQEFKRAQKAENLLKLAAEKLGKDFETAWRE 
           ________________________________________________________________________________________________________________________ 

           ____________________________________________171_________________________________________________________________________ 
 1yz6(A) : VWVPLEEEWGEVYAAFEDAAKDGIDVLKGHVPDEWLPVLKEIIDNYVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVEVKFTYLGAPRYRIDITAPDYYKAEEVLESIA 
         :                                                                                                                          
 1yz7(A) : VWVPLEEEWGEVYAAFEDAAKDGIDVLKGHVPDEWLPVLKEIIDNYVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVEVKFTYLGAPRYRIDITAPDYYKAEEVLESIA 
           ____________________________________________171_________________________________________________________________________ 

           ______________________                                                                                                   
 1yz6(A) : EEILRVIKEAGGEATLLRKEK*                                                                                                   
         :                                                                                                                          
 1yz7(A) : EEILRVIKEAGGEATLLRKEKR                                                                                                   
           ______________________                                                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		110.3
Translation
(A) 		1.1
Closure
(%) 		11.3
Bending Residues
( green ) 		  171 - 175
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download