Proliferating Cell Nuclear Antigen

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Proliferating Cell Nuclear Antigen
  Conformer 1
(PDB) 		1iz5 (B)
  Conformer 2
(PDB) 		1ge8 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 118 1.01   15 - 20   47 - 49   128 - 231   240 - 244
2 115 0.76   4 - 14   21 - 46   50 - 127   232 - 239

Sequence


           ___________14____20________________________46_49__________________________________________________________________126___ 
 1iz5(B) : PFEIVFEGAKEFAQLIDTASKLIDEAAFKVTEDGISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNLDHLKKILKRGKAKDTLILKKGEENFLEITIQGTATRTFRVPLIDVEEp 
         :                                                                                                                          
 1ge8(A) : PFEIVFEGAKEFAQLIDTASKLIDEAAFKVTEDGISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNLDHLKKILKRGKAKDTLILKKGEENFLEITIQGTATRTFRVPLID---p 
           ___________14____20________________________46_49__________________________________________________________________126___ 

           _____________________________________________________________________________________________________230______239_______ 
 1iz5(B) : ELPFTAKVVVLGEVLKAAVKAASLVSDSIKFIARENEFIMKAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSDMVKGLGKADEVTIKFGNEMPMQMEYYIRDEGRLTFLLAPR 
         :                                                                                                                          
 1ge8(A) : ELPFTAKVVVLGEVLKDAVKDASLVSDSIKFIARENEFIMKAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSDMVKGLGKADEVTIKFGNEMPMQMEYYIRDEGRLTFLLAPR 
           _____________________________________________________________________________________________________230______239_______ 

           _                                                                                                                        
 1iz5(B) : *                                                                                                                        
         :                                                                                                                          
 1ge8(A) : V                                                                                                                        
           _                                                                                                                        

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.1
Translation
(A) 		-0.2
Closure
(%) 		3.1
Bending Residues
( green ) 		  14 - 15
  20 - 24
  46 - 47
  49 - 50
  126 - 129
  230 - 233
  239 - 240
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download