Protein Ninb

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Protein Ninb
  Conformer 1
(PDB) 		1pc6 (A)
  Conformer 2
(PDB) 		1pc6 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 86 0.66   44 - 129
2 41 2.48   3 - 43

Sequence


           _________________________________________43_____________________________________________________________________________ 
 1pc6(A) : MKKLTFEIRSPAHQQNAIHAVQQILPDPTKPIVVTIQERNRSLDQNRKLWACLGDVSRQVEWHGRWLDAESWKCVFTAALKQQDVVPNLAGNGFVVIGQSTSRMRVGEFAELLELIQAFG 
         :                                                                                                                          
 1pc6(B) : MKKLTFEIRSPAHQQNAIHAVQQILPDPTKPIVVTIQERNRSLDQNRKLWACLGDVSRQVEWHGRWLDAESWKCVFTAALKQQDVVPNLAGNGFVVIGQSTSRMRVGEFAELLELIQAFG 
           _________________________________________43_____________________________________________________________________________ 

           _____________________                                                                                                    
 1pc6(A) : TERGVKWSDEARLALEWKARW                                                                                                    
         :                                                                                                                          
 1pc6(B) : TERGVKWSDEARL********                                                                                                    
           _____________________                                                                                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		67.6
Translation
(A) 		-6.4
Closure
(%) 		90.4
Bending Residues
( green ) 		  43 - 46
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download