Protein-Tyrosine Phosphatase Yoph

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Protein-Tyrosine Phosphatase Yoph
  Conformer 1
(PDB) 		1k46 (A)
  Conformer 2
(PDB) 		1huf (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 96 0.95   28 - 123
2 23 0.13   5 - 27

Sequence


           ________________________27______________________________________________________________________________________________ 
 1k46(A) : NLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLRSDQMTLQDAKVLLEAAL 
         :                                                                                                                          
 1huf(A) : *LSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLRSDQMTLQDAKVLLEAAL 
           ________________________27______________________________________________________________________________________________ 

           ____                                                                                                                     
 1k46(A) : RQES                                                                                                                     
         :                                                                                                                          
 1huf(A) : RQES                                                                                                                     
           ____                                                                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		179.7
Translation
(A) 		-0.1
Closure
(%) 		86.2
Bending Residues
( green ) 		  27 - 31
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download