Proto-Oncogene Tyrosine-Protein Kinase Src

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Proto-Oncogene Tyrosine-Protein Kinase Src
  Conformer 1
(PDB) 		1yi6 (B)
  Conformer 2
(PDB) 		1fmk  
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 169 1.17   318 - 326   343 - 403   406 - 518
2 74 1.85   261 - 317   327 - 342   404 - 405

Sequence


           ________________________________________________________________________________________________________________________ 
 1yi6(B) : ************************************************************************************************************************ 
         :                                                                                                                          
 1fmk    : MVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKH 
           ________________________________________________________________________________________________________________________ 

           _________________________________________________________________________________________________________________317____ 
 1yi6(B) : ********************************************************DAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEK 
         :                                                                                                                          
 1fmk    : YKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEK 
           _________________________________________________________________________________________________________________317____ 

           __326_____________342__________________________________________________________403______________________________________ 
 1yi6(B) : LVQLYAVVSEEPI-iVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEtARQGAKFPIKWTAPEAALYGRFTIK 
         :                                                                                                                          
 1fmk    : LVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLAR-------------fPIKWTAPEAALYGRFTIK 
           __326_____________342__________________________________________________________403______________________________________ 

           ___________________________________________________________________________________________                              
 1yi6(B) : SDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL                              
         :                                                                                                                          
 1fmk    : SDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQ-qPGENL                              
           ___________________________________________________________________________________________                              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		22.1
Translation
(A) 		1.1
Closure
(%) 		74.5
Bending Residues
( green ) 		  317 - 318
  326 - 327
  342 - 343
  403 - 426
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download