Proto-Oncogene Tyrosine-Protein Kinase Src

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Proto-Oncogene Tyrosine-Protein Kinase Src
  Conformer 1
(PDB) 		1p13 (B)
  Conformer 2
(PDB) 		1o4g (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 67 1.23   162 - 186   214 - 255
2 26 1.32   187 - 213

Sequence


           _____________________________186________________________213_______________________________________________               
 1p13(B) : ***AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCP*               
         :                                                                                                                          
 1o4g(A) : SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAY-lSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT               
           ______________________________32_________________________59_______________________________________________               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.6
Translation
(A) 		-0.4
Closure
(%) 		19.9
Bending Residues
( green ) 		  186 - 188
  213 - 214
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download