Putative Nickel-Responsive Regulator

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Putative Nickel-Responsive Regulator
  Conformer 1
(PDB) 		2ca9 (B)
  Conformer 2
(PDB) 		2caj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 82 1.63   58 - 139
2 42 0.88   11 - 52

Sequence


           _________________________________________51_____________________________________________________________________________ 
 2ca9(B) : SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIG 
         :                                                                                                                          
 2caj(A) : SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVED-----nPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIG 
           _________________________________________51_____________________________________________________________________________ 

           ___________________                                                                                                      
 2ca9(B) : GLRGVKFAKLTKASSFEYN                                                                                                      
         :                                                                                                                          
 2caj(A) : GLRGVKFAKLTKA******                                                                                                      
           ___________________                                                                                                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		142.3
Translation
(A) 		5.9
Closure
(%) 		95.5
Bending Residues
( green ) 		  51 - 65
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download