Putative Tetr-Family Transcriptional Regulator

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Putative Tetr-Family Transcriptional Regulator
  Conformer 1
(PDB) 		2g3b (B)
  Conformer 2
(PDB) 		2g3b (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 130 1.46   5 - 15   54 - 91   104 - 186
2 51 1.23   4 - 4   16 - 53   92 - 103

Sequence


           __4_________15____________________________________53____________________________________91_________103__________________ 
 2g3b(B) : SERRDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEAALNYINDRARAYRSEGEGSGDSARDRLTRSLLGEIQDRPEVVENSLAWNELRASAVYEEALRDPLART 
         :                                                                                                                          
 2g3b(A) : SERRDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEAALNYINDRARAYRSEGEG-gDSARDRLTRSLLGEIQDRPEVVENSLAWNELRASAVYEEALRDPLART 
           __4_________15____________________________________53____________________________________91_________103__________________ 

           __________________________________________________________________                                                       
 2g3b(B) : TAAWVSEIADAIVQAQATGEISRSLDPQPTAVTtALVEGLSGRWLCKEISTEDARSHLLGAIDVVs                                                       
         :                                                                                                                          
 2g3b(A) : TAAWVSEIADAIVQAQATGEISRSLDPQPTAVTtALVEGLSGRWLCKEISTEDARSHLLGAIDVVs                                                       
           __________________________________________________________________                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.1
Translation
(A) 		0.1
Closure
(%) 		80.9
Bending Residues
( green ) 		  4 - 5
  15 - 16
  53 - 54
  91 - 92
  103 - 104
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download