Pyrimidine Pathway Regulator 1 (Ppr1)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Pyrimidine Pathway Regulator 1 (Ppr1)
  Conformer 1
(PDB) 		1pyi (A)
  Conformer 2
(PDB) 		1pyi (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 45 2.08   32 - 76
2 21 0.56   77 - 97

Sequence


           _____________________________________________76_________________________________________                                 
 1pyi(A) : SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYGVDPTKIRGNIPATSDDEPFDLK                                 
         :                                                                                                                          
 1pyi(B) : SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYGVDPT******************                                 
           _____________________________________________76_________________________________________                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		71.3
Translation
(A) 		1.5
Closure
(%) 		93.0
Bending Residues
( green ) 		  76 - 77
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download