Rab5 Gdp/gtp Exchange Factor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Rab5 Gdp/gtp Exchange Factor
  Conformer 1
(PDB) 		2fif (B)
  Conformer 2
(PDB) 		2fif (F)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 30 0.38   41 - 70
2 22 0.56   19 - 40

Sequence


           ________________________40_________________________________                                                              
 2fif(B) : SELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASSQ                                                              
         :                                                                                                                          
 2fif(F) : **LLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASS*                                                              
           ________________________40_________________________________                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		26.8
Translation
(A) 		0.6
Closure
(%) 		99.7
Bending Residues
( green ) 		  40 - 41
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download