Rad50 Abc-Atpase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Rad50 Abc-Atpase
  Conformer 1
(PDB) 		1ii8 (B)
  Conformer 2
(PDB) 		1f2u (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 72 1.02   740 - 811
2 69 2.21   812 - 880

Sequence


           ____________________________________________________________________________________________________811_________________ 
 1ii8(B) : RERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYL 
         :                                                                                                                          
 1f2u(B) : *****************************ALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYL 
           ____________________________________________________________________________________________________811_________________ 

           ______________________________________________________                                                                   
 1ii8(B) : DEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS                                                                   
         :                                                                                                                          
 1f2u(B) : DEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS                                                                   
           ______________________________________________________                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		31.3
Translation
(A) 		-0.7
Closure
(%) 		6.7
Bending Residues
( green ) 		  811 - 812
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download