Ras-Related Protein Rab-6a

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ras-Related Protein Rab-6a
  Conformer 1
(PDB) 		2gil (B)
  Conformer 2
(PDB) 		2ffq (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 100 0.39   22 - 45   70 - 81   92 - 94   109 - 120   123 - 171
2 54 1.32   16 - 21   48 - 69   82 - 91   95 - 108   121 - 122

Sequence


           _______21_________________40___________________________69__________81________91_94___________108_________120____________ 
 2gil(B) : KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLAD 
         :                                                                                                                          
 2ffq(A) : KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLAD 
           _______21_________________40___________________________69__________81________91_94___________108_________120____________ 

           ____________________________________________                                                                             
 2gil(B) : KRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL**                                                                             
         :                                                                                                                          
 2ffq(A) : KRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALLE                                                                             
           ____________________________________________                                                                             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.1
Translation
(A) 		-0.2
Closure
(%) 		51.7
Bending Residues
( green ) 		  21 - 22
  40 - 48
  69 - 70
  81 - 82
  91 - 92
  94 - 95
  108 - 109
  120 - 123
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download