Retinoblastoma-Associated Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Retinoblastoma-Associated Protein
  Conformer 1
(PDB) 		1gh6 (B)
  Conformer 2
(PDB) 		1n4m (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 186 0.84   385 - 561   563 - 577   654 - 654
2 128 0.78   562 - 562   582 - 653   655 - 770

Sequence


           ________________________________________________________________________________________________________________________ 
 1gh6(B) : MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGAGCVAIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATY 
         :                                                                                                                          
 1n4m(A) : *NTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGAGCVAIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATY 
           ________________________________________________________________________________________________________________________ 

           ____________________________________________________________561____________576_____________653__________________________ 
 1gh6(B) : SRST-------tDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKLVPRGSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHI 
         :                                                                                                                          
 1n4m(A) : SRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKTREGKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHI 
           ____________________________________________________________561____________576_____________653__________________________ 

           __________________________________________________________________________________________________________               
 1gh6(B) : IWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYA*************               
         :                                                                                                                          
 1n4m(A) : IWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHI               
           __________________________________________________________________________________________________________               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.3
Translation
(A) 		0.3
Closure
(%) 		89.3
Bending Residues
( green ) 		  561 - 563
  576 - 582
  653 - 655
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download