Rho-Associated, Coiled-Coil Containing Protein Kinase 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Rho-Associated, Coiled-Coil Containing Protein Kinase 1
  Conformer 1
(PDB) 		1s1c (Y)
  Conformer 2
(PDB) 		1s1c (X)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 29 0.64   979 - 1007
2 24 0.84   955 - 978

Sequence


           _______________________________978____________________________________                                                   
 1s1c(Y) : GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKD                                                   
         :                                                                                                                          
 1s1c(X) : GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRK*                                                   
           _______________________________978____________________________________                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		13.9
Translation
(A) 		0.6
Closure
(%) 		99.3
Bending Residues
( green ) 		  978 - 979
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download