Ribose Abc Transporter, Periplasmic Ribose- Binding Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ribose Abc Transporter, Periplasmic Ribose- Binding Protein
  Conformer 1
(PDB) 		2fn9 (A)
  Conformer 2
(PDB) 		2fn9 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 143 0.2   106 - 243   275 - 279
2 133 0.3   4 - 105   244 - 274

Sequence


           _________________________________________________________________________________________________101____________________ 
 2fn9(A) : GKMAIVISTLNNPWFVVLAETAKQRAEQLGYEATIFDSQNDTAKESAHFDAIIAAGYDAIIFNPTDADGSIANVKRAKEAGIPVFCVDRGINARGLAVAQIYSDNYYGGVLAGEYFVKFL 
         :                                                                                                                          
 2fn9(B) : GKMAIVISTLNNPWFVVLAETAKQRAEQLGYEATIFDSQNDTAKESAHFDAIIAAGYDAIIFNPTDADGSIANVKRAKEAGIPVFCVDRGINARGLAVAQIYSDNYYGGVLAGEYFVKFL 
           _________________________________________________________________________________________________101____________________ 

           ______________________________________________________________________________________________________________________24 
 2fn9(A) : KEKYPDAKEIPYAELLGILSAQPTWDRSNGFHSVVDQYPEFKMVAQQSAEFDRDTAYKVTEQILQAHPEIKAIWCGNDAMALGAMKACEAAGRTDIYIFGFDGAEDVINAIKEGKQIVAT 
         :                                                                                                                          
 2fn9(B) : KEKYPDAKEIPYAELLGILSAQPTWDRSNGFHSVVDQYPEFKMVAQQSAEFDRDTAYKVTEQILQAHPEIKAIWCGNDAMALGAMKACEAAGRTDIYIFGFDGAEDVINAIKEGKQIVAT 
           ______________________________________________________________________________________________________________________24 

           2___________________________272_________                                                                                 
 2fn9(A) : IMQFPKLMARLAVEWADQYLRGERSFPEIVPVTVELVTRE                                                                                 
         :                                                                                                                          
 2fn9(B) : IMQFPKLMARLAVEWADQYLRGERSFPEIVPVTVELVTRE                                                                                 
           2___________________________272_________                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.3
Translation
(A) 		1.0
Closure
(%) 		78.3
Bending Residues
( green ) 		  101 - 106
  242 - 246
  272 - 279
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download