Rop

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Rop
  Conformer 1
(PDB) 		1nkd  
  Conformer 2
(PDB) 		1gmg (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 29 1.07   3 - 32
2 23 0.48   34 - 56

Sequence


           ___________________________29______________________________                                                              
 1nkd    : MTKQEKTALNMARFIRSQTLTLLEKLNELADAADEQADICESLHDHADELYRSCLARFG                                                              
         :                                                                                                                          
 1gmg(A) : MTKQEKTALNMARFIRSQTLTLLEKLNEL-DP-DEQADICESLHDHADELYRSCLARF*                                                              
           ___________________________29______________________________                                                              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		147.8
Translation
(A) 		-3.8
Closure
(%) 		91.7
Bending Residues
( green ) 		  29 - 34
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download