Rop

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Rop
  Conformer 1
(PDB) 		1gto (A)
  Conformer 2
(PDB) 		1qx8 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 27 0.49   3 - 29
2 20 0.44   35 - 54

Sequence


           __________________________28__________________________________                                                           
 1gto(A) : GTKQEKTALNMARFIRSQTLTLLEKLNELGADEQADICESLHDHADELYRSCLARFGDDGEN                                                           
         :                                                                                                                          
 1qx8(B) : MTKQEKTALNMARFIRSQTLTLLEKLNEL-----ADICESLHDHADELYRSCLARF******                                                           
           __________________________28__________________________________                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		174.4
Translation
(A) 		0.9
Closure
(%) 		60.2
Bending Residues
( green ) 		  28 - 36
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download