Saposin B

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Saposin B
  Conformer 1
(PDB) 		1n69 (B)
  Conformer 2
(PDB) 		1n69 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 39 1.5   26 - 64
2 35 1.21   3 - 25   65 - 76

Sequence


           ____________________20__________________________________________64______________                                         
 1n69(B) : MDGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCD                                         
         :                                                                                                                          
 1n69(A) : **GDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCD                                         
           ____________________20__________________________________________64______________                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		26.9
Translation
(A) 		0.5
Closure
(%) 		0.1
Bending Residues
( green ) 		  20 - 26
  64 - 65
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download