Septum Site-Determining Protein Minc

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Septum Site-Determining Protein Minc
  Conformer 1
(PDB) 		1hf2 (A)
  Conformer 2
(PDB) 		1hf2 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 106 0.26   99 - 204
2 85 0.75   4 - 98

Sequence


           ________________________________________________________________________________________________98______________________ 
 1hf2(A) : MVDFKMTKEGLVLLIKDYQNLEEVLNAISARITQMGGFFAKGDRISLMIENHNKHSQDIPRIVSHLRNLGLEVSQILVG----------kVQSRTTVESTGKVIKRNIRSGQTVVHSGDV 
         :                                                                                                                          
 1hf2(B) : *VDFKMTKEGLVLLIKDYQNLEEVLNAISARITQMGGFFAKGDRISLMIENHNKHSQDIPRIVSHLRNLGLEVSQILVGSTVEGKENDLKVQSRTTVESTGKVIKRNIRSGQTVVHSGDV 
           ________________________________________________________________________________________________98______________________ 

           _______________________________________________________________________________________                                  
 1hf2(A) : IVFGNVNKGAEILAGGSVVVFGKAQGNIRAGLNEGGQAVVAALDLQTSLIQIAGFITHSKGEENVPSIAHVKGNRIVIEPFDKVSF*                                  
         :                                                                                                                          
 1hf2(B) : IVFGNVNKGAEILAGGSVVVFGKAQGNIRAGLNEGGQAVVAALDLQTSLIQIAGFITHSKGEENVPSIAHVKGNRIVIEPFDKVSFE                                  
           _______________________________________________________________________________________                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		22.0
Translation
(A) 		0.2
Closure
(%) 		72.0
Bending Residues
( green ) 		  98 - 103
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download