Seventeen Kilodalton Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Seventeen Kilodalton Protein
  Conformer 1
(PDB) 		1sg2 (A)
  Conformer 2
(PDB) 		1u2m (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 68 0.96   15 - 33   102 - 151
2 64 0.65   34 - 101

Sequence


           ____________________33_________________________________________________________________101______________________________ 
 1sg2(A) : *ADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDA 
         :                                                                                                                          
 1u2m(C) : GaDKIAIVN-gSLFQQVAQKTGVSNTLENEFKGRASELQR-eTDLQAK-kKLQS-kAGSDRTKLEKDV-aQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDA 
           ____________________41_________________________________________________________________109______________________________ 

           ______________________                                                                                                   
 1sg2(A) : NAVAYNSSDVKDITADVLKQVK                                                                                                   
         :                                                                                                                          
 1u2m(C) : NAVAYNSSDVKDITADVLKQVK                                                                                                   
           ______________________                                                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		25.8
Translation
(A) 		0.1
Closure
(%) 		66.0
Bending Residues
( green ) 		  33 - 34
  101 - 102
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download