Sex-Lethal

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Sex-Lethal
  Conformer 1
(PDB) 		3sxl (A)
  Conformer 2
(PDB) 		1b7f (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 77 1.9   202 - 287
2 73 0.56   126 - 201

Sequence


           ___________________________________________________________________________200__________________________________________ 
 3sxl(A) : *NTNLIVNYLPQD-tDRELYALFRAIGPINTCRI-rDYKTGYSFGYAFVDFTSE-dSQRAIKVLNGITVRNKRLKVSYARP--eSIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNI 
         :                                                                                                                          
 1b7f(B) : SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNI 
           ___________________________________________________________________________200__________________________________________ 

           _______________________________________________                                                                          
 3sxl(A) : LRDKLTGRPRGVAFVRYNKREEAQEAISALNNV-------pLSVRLA                                                                          
         :                                                                                                                          
 1b7f(B) : LRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLA                                                                          
           _______________________________________________                                                                          

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		55.4
Translation
(A) 		1.1
Closure
(%) 		98.3
Bending Residues
( green ) 		  200 - 206
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download