Shikimate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Shikimate Kinase
  Conformer 1
(PDB) 		2dft (B)
  Conformer 2
(PDB) 		2dft (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 107 0.96   4 - 31   72 - 82   87 - 164
2 44 0.83   32 - 71   83 - 86

Sequence


           __________________________29________________________________________71_________82_85____________________________________ 
 2dft(B) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLA 
         :                                                                                                                          
 2dft(C) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGG-------- 
           __________________________29________________________________________71_________82_85____________________________________ 

           _____________________________________________                                                                            
 2dft(B) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL                                                                            
         :                                                                                                                          
 2dft(C) : --dRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL                                                                            
           _____________________________________________                                                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.3
Translation
(A) 		0.4
Closure
(%) 		99.6
Bending Residues
( green ) 		  29 - 32
  71 - 73
  82 - 83
  85 - 87
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download