Shikimate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Shikimate Kinase
  Conformer 1
(PDB) 		1e6c (A)
  Conformer 2
(PDB) 		1shk (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 131 1.41   3 - 103   139 - 168
2 22 2.72   104 - 138

Sequence


           ___________________________________________________________________________________________________102__________________ 
 1e6c(A) : MTEPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLQAHQR 
         :                                                                                                                          
 1shk(B) : MTEPIFMVGARGCGKTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQ-------- 
           ___________________________________________________________________________________________________102__________________ 

           _______________138__________________________________                                                                     
 1e6c(A) : PTLTGRPIAEEMEAVLREREALYQDVAHYVVDATQPPAAIVCELMQTMRL**                                                                     
         :                                                                                                                          
 1shk(B) : -----rPIAEEMEAVLREREALYQDVAHYVVDATQPPAAIVCELMQTMRLPA                                                                     
           _______________138__________________________________                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		28.8
Translation
(A) 		-3.0
Closure
(%) 		99.9
Bending Residues
( green ) 		  102 - 104
  138 - 139
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download