Sortase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Sortase
  Conformer 1
(PDB) 		1t2o (B)
  Conformer 2
(PDB) 		1t2p (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 111 1.01   66 - 119   127 - 183   198 - 203
2 21 1.11   120 - 126   184 - 197

Sequence


           _______________________________________________________119____126______________________________________________________1 
 1t2o(B) : **QIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGS-vYFKVGNETRKYK-tSIRDVKPTDVGV----kGKDKQLTL 
         :                                                                                                                          
 1t2p(A) : KPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTL 
           _______________________________________________________119____126______________________________________________________1 

           83___________197_________                                                                                                
 1t2o(B) : ITADDYNEKTGVWEKRKIFVATEV*                                                                                                
         :                                                                                                                          
 1t2p(A) : ITCDDYNEKTGVWEKRKIFVATEVK                                                                                                
           83___________197_________                                                                                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.6
Translation
(A) 		-0.4
Closure
(%) 		96.1
Bending Residues
( green ) 		  119 - 120
  126 - 127
  183 - 184
  197 - 198
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download