Staphylococcal Accessory Regulator A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Staphylococcal Accessory Regulator A
  Conformer 1
(PDB) 		2frh (A)
  Conformer 2
(PDB) 		1fzp (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 34 3.71   110 - 143
2 23 4.26   192 - 214

Sequence


           __________________________________________142___________________________________________________________________________ 
 2frh(A) : GSHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITE 
         :                                                                                                                          
 1fzp(B) : ****AITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDI----------vVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRIT* 
           ___________________________________________42___________________________________________________________________________ 

           _______                                                                                                                  
 2frh(A) : ANNEIEL                                                                                                                  
         :                                                                                                                          
 1fzp(B) : *******                                                                                                                  
           _______                                                                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		115.8
Translation
(A) 		-42.5
Closure
(%) 		10.6
Bending Residues
( green ) 		  142 - 197
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download