Streptokinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Streptokinase
  Conformer 1
(PDB) 		1c4p (B)
  Conformer 2
(PDB) 		1qqr (B)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 87 0.63   156 - 162   166 - 176   184 - 226   228 - 245   271 - 278
2 36 1.69   163 - 165   177 - 183   227 - 227   246 - 270

Sequence


           ___________162______171_________183________________________________________226________________245______________________2 
 1c4p(B) : KPIQNQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKTHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYEINKKSGLNEEINNTD 
         :                                                                                                                          
 1qqr(B) : **IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTD 
           ___________162______171_________183________________________________________226________________245______________________2 

           70_______________                                                                                                        
 1c4p(B) : LISEKYYVLKKGEKPYD                                                                                                        
         :                                                                                                                          
 1qqr(B) : LISEKYYVLKKGEKP**                                                                                                        
           70_______________                                                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.9
Translation
(A) 		-0.2
Closure
(%) 		54.5
Bending Residues
( green ) 		  162 - 163
  165 - 166
  171 - 177
  183 - 184
  226 - 231
  245 - 246
  270 - 271
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download