Tata-Binding Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tata-Binding Protein
  Conformer 1
(PDB) 		1ais (A)
  Conformer 2
(PDB) 		1pcz (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 90 0.69   4 - 13   69 - 74   106 - 179
2 86 0.73   14 - 68   75 - 105

Sequence


           ___________13_____________________________________________________68____74____________________________105_______________ 
 1ais(A) : MVDMSKVKLRIENIVASVDLFAQLDLEKVLDLCPNSKYNPEEFPGIICHLDDPKVALLIFSSGKLVVTGAKSVQDIERAVAKLAQKLKSIGVKFKRAPQIDVQNMVFSGDIGREFNLDVV 
         :                                                                                                                          
 1pcz(B) : *VDMSKVKLRIENIVASVDLFAQLDLEKVLDLCPNSKYNPEEFPGIICHLDDPKVALLIFSSGKLVVTGAKSVQDIERAVAKLAQKLKSIGVKFKRAPQIDVQNMVFSGDIGREFNLDVV 
           ___________13_____________________________________________________68____74____________________________105_______________ 

           ________________________________________________________________                                                         
 1ais(A) : ALTLPNCEYEPEQFPGVIYRVKEPKSVILLFSSGKIVCSGAKSEADAWEAVRKLLRELDKY***                                                         
         :                                                                                                                          
 1pcz(B) : ALTLPNCEYEPEQFPGVIYRVKEPKSVILLFSSGKIVCSGAKSEADAWEAVRKLLRELDKYGLL                                                         
           ________________________________________________________________                                                         

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		13.6
Translation
(A) 		0.8
Closure
(%) 		6.8
Bending Residues
( green ) 		  13 - 14
  68 - 69
  74 - 75
  105 - 106
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download