Tetracycline Repressor Class D

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tetracycline Repressor Class D
  Conformer 1
(PDB) 		2trt  
  Conformer 2
(PDB) 		1bjz  
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 103 0.73   62 - 88   111 - 199
2 68 0.41   7 - 61   89 - 101

Sequence


           __________________________________________________________61_________________________88_________99______________________ 
 2trt    : ARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMT 
         :                                                                                                                          
 1bjz    : SRLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMT 
           __________________________________________________________61_________________________88_________99______________________ 

           ______________________________________________________________________________                                           
 2trt    : ENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALnLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQIV                                           
         :                                                                                                                          
 1bjz    : ENGFSLRDGLYAISAVSHFTLGAVLEQQEH----nLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQIV                                           
           ______________________________________________________________________________                                           

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.8
Translation
(A) 		-0.2
Closure
(%) 		72.9
Bending Residues
( green ) 		  61 - 62
  88 - 89
  99 - 116
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download