Thermosome

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Thermosome
  Conformer 1
(PDB) 		1asx  
  Conformer 2
(PDB) 		1ass  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 119 0.63   3 - 31   58 - 82   86 - 150
2 29 0.77   32 - 57   83 - 85

Sequence


           _____________________________31________________________57_______________________82_85___________________________________ 
 1asx    : MSGIVIDKEKVHSKMPDVVKNAKIALIDSALEIKKTEIEAKVQISDPSKIQDFLNQETNTFKQMVEKIKKSGANVVLCQKGIDDVAQHYLAKEGIYAVRRVKKSDMEKLAKATGAKIVTD 
         :                                                                                                                          
 1ass    : MSGIVIDKEKVHSKMPDVVKNAKIALIDSALEIKKTEIEAKVQISDPSKIQDFLNQETNTFKQMVEKIKKSGANVVLCQKGIDDVAQHYLAKEGIYAVRRVKKSDMEKLAKATGAKIVTD 
           _____________________________31________________________57_______________________82_85___________________________________ 

           ________________________________                                                                                         
 1asx    : LDDLTPSVLGEAETVEERKIGDDRMTFVMGCK                                                                                         
         :                                                                                                                          
 1ass    : LDDLTPSVLGEAETVEERKIGDDRMTFVMGCK                                                                                         
           ________________________________                                                                                         

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		19.7
Translation
(A) 		0.6
Closure
(%) 		24.3
Bending Residues
( green ) 		  31 - 34
  57 - 62
  82 - 83
  85 - 87
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download