Transcription Initiation Factor IIf, Alpha Subunit

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcription Initiation Factor IIf, Alpha Subunit
  Conformer 1
(PDB) 		1f3u (F)
  Conformer 2
(PDB) 		1f3u (D)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 126 0.96   18 - 126   139 - 165
2 20 0.85   10 - 17   127 - 138

Sequence


           ___________17_________________________________________________________________________________________________126_______ 
 1f3u(F) : GPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEM-rKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDG 
         :                                                                                                                          
 1f3u(D) : **SSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPrKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDG 
           ___________17_________________________________________________________________________________________________126_______ 

           __138______________________________                                                                                      
 1f3u(F) : AFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRN                                                                                      
         :                                                                                                                          
 1f3u(D) : AFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRN                                                                                      
           __138______________________________                                                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.2
Translation
(A) 		-0.7
Closure
(%) 		8.1
Bending Residues
( green ) 		  17 - 18
  126 - 127
  138 - 139
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download