Transcription Elongation Protein Nusa

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcription Elongation Protein Nusa
  Conformer 1
(PDB) 		2atw (C)
  Conformer 2
(PDB) 		1k0r (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 125 0.63   110 - 205   224 - 230   235 - 235   238 - 258
2 93 0.67   206 - 223   231 - 234   236 - 237   259 - 327

Sequence


           ________________________________________________________________________________________________________________________ 
 2atw(C) : *****************************************************************************************************GEFSTREGEIVAGVIQRDS 
         :                                                                                                                          
 1k0r(B) : VSRRHMNIDMAALHAIEVDRGISVNELLETIKSALLTAYRHTQGHQTDARIEIDRKTGVVRVIARETDEAGNLISEWDDTPEGFGRIAATTARQVMLQRFRDAEsTREGEIVAGVIQRDS 
           ________________________________________________________________________________________________________________________ 

           _______________________________________________________________________________205_______________223____230_234_________ 
 2atw(C) : RANARGLVVVRIGTETKASEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRV 
         :                                                                                                                          
 1k0r(B) : RANARGLVVVRIGTETKASEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRV 
           _______________________________________________________________________________205_______________223____230_234_________ 

           ____________258_______________________________________________________________________                                   
 2atw(C) : RNVMSELSGEKIDIIDYDDDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDAPP                                   
         :                                                                                                                          
 1k0r(B) : RNVMSELSGEKIDIIDYDDDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDAPP                                   
           ____________258_______________________________________________________________________                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.8
Translation
(A) 		0.0
Closure
(%) 		93.5
Bending Residues
( green ) 		  205 - 206
  223 - 224
  230 - 231
  234 - 241
  258 - 259
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download