Transcriptional Repressor Ethr

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Repressor Ethr
  Conformer 1
(PDB) 		1u9o (A)
  Conformer 2
(PDB) 		1t56 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 104 0.79   81 - 110   115 - 116   141 - 212
2 85 0.52   24 - 80   111 - 114   117 - 140

Sequence


           _________________________________________________________80___________________________110_114______________________139__ 
 1u9o(A) : GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTF 
         :                                                                                                                          
 1t56(A) : GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTF 
           _________________________________________________________80___________________________110_114______________________139__ 

           __________________________________________________________________________                                               
 1u9o(A) : MQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGEN                                               
         :                                                                                                                          
 1t56(A) : MQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE*                                               
           __________________________________________________________________________                                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.3
Translation
(A) 		-0.3
Closure
(%) 		98.5
Bending Residues
( green ) 		  80 - 81
  110 - 111
  114 - 117
  139 - 141
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download