Troponin C

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Troponin C
  Conformer 1
(PDB) 		1ytz (C)
  Conformer 2
(PDB) 		1top  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 127 1.87   5 - 37   66 - 159
2 28 1.5   38 - 65

Sequence


           ____________________________________37__________________________65______________________________________________________ 
 1ytz(C) : ***TDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGE 
         :                                                                                                                          
 1top    : ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGE 
           ____________________________________38__________________________66______________________________________________________ 

           __________________________________________                                                                               
 1ytz(C) : ILRATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ                                                                               
         :                                                                                                                          
 1top    : ILRATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ                                                                               
           __________________________________________                                                                               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		47.8
Translation
(A) 		1.8
Closure
(%) 		97.4
Bending Residues
( green ) 		  37 - 39
  65 - 70
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download