Troponin C

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Troponin C
  Conformer 1
(PDB) 		1tcf  
  Conformer 2
(PDB) 		1tn4  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 104 0.61   4 - 100   103 - 106   152 - 154
2 48 0.57   101 - 102   107 - 151   155 - 155

Sequence


           _________________________________________________________________________________________________100___106______________ 
 1tcf    : *DQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFR 
         :                                                                                                                          
 1tn4    : TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFR 
           _________________________________________________________________________________________________100___106______________ 

           ____________________________151______                                                                                    
 1tcf    : ASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG                                                                                    
         :                                                                                                                          
 1tn4    : ASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG                                                                                    
           ____________________________151______                                                                                    

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.5
Translation
(A) 		-0.3
Closure
(%) 		83.3
Bending Residues
( green ) 		  100 - 103
  106 - 107
  151 - 155
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download