Tryparedoxin II

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tryparedoxin II
  Conformer 1
(PDB) 		1oc8 (A)
  Conformer 2
(PDB) 		1fg4 (B)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 73 0.47   22 - 27   47 - 66   82 - 128
2 49 0.82   41 - 46   67 - 81   129 - 156

Sequence


           ___________27_________________46__________________66_____________81____________________________________________128______ 
 1oc8(A) : HMSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEAD 
         :                                                                                                                          
 1fg4(B) : ***GLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEAD 
           ___________12_________________30__________________50_____________65____________________________________________112______ 

           _______________________________                                                                                          
 1oc8(A) : SGNIITTQARTMVVKDPEAKDFPWPNVEAKK                                                                                          
         :                                                                                                                          
 1fg4(B) : SGNIITTQARTMVVKDPEAKDFPWPN*****                                                                                          
           _______________________________                                                                                          

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.1
Translation
(A) 		0.0
Closure
(%) 		13.4
Bending Residues
( green ) 		  27 - 43
  46 - 48
  66 - 67
  81 - 82
  128 - 129
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download