Tryptophan Rna-Binding Attenuator Protein-Inhibitory Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tryptophan Rna-Binding Attenuator Protein-Inhibitory Protein
  Conformer 1
(PDB) 		2bx9 (I)
  Conformer 2
(PDB) 		2bx9 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 26 0.21   3 - 10   34 - 51
2 23 0.6   11 - 33

Sequence


           ________10____________________32_____________________                                                                    
 2bx9(I) : MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK                                                                    
         :                                                                                                                          
 2bx9(D) : MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK                                                                    
           ________10____________________32_____________________                                                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		24.6
Translation
(A) 		0.4
Closure
(%) 		64.1
Bending Residues
( green ) 		  10 - 11
  32 - 34
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download