Ubiquitin-Conjugating Enzyme E2 D3

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ubiquitin-Conjugating Enzyme E2 D3
  Conformer 1
(PDB) 		1x23 (C)
  Conformer 2
(PDB) 		1z2u (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 73 0.41   21 - 22   35 - 53   68 - 78   105 - 145
2 72 0.63   1 - 20   23 - 34   54 - 67   79 - 104

Sequence


           ____________________17_______________34_________________53____________67________77________________________104___________ 
 1x23(C) : GSPEFMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNP 
         :                                                                                                                          
 1z2u(A) : **GSHMALKRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNP 
           ____________________17_______________34_________________53____________67________77________________________104___________ 

           ________________________________                                                                                         
 1x23(C) : DDPLVPEIARIYKTDRDKYNRISREWTQKYAM                                                                                         
         :                                                                                                                          
 1z2u(A) : DDPLVPEIARIYKTDRERYNQLAREWTQKYAM                                                                                         
           ________________________________                                                                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.3
Translation
(A) 		0.2
Closure
(%) 		82.6
Bending Residues
( green ) 		  17 - 23
  34 - 35
  53 - 54
  67 - 68
  77 - 79
  104 - 105
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download