Vp4

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Vp4
  Conformer 1
(PDB) 		1slq (B)
  Conformer 2
(PDB) 		2b4h (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 160 0.86   274 - 355   370 - 408   427 - 465
2 48 3.29   264 - 273   356 - 369   409 - 426   466 - 471

Sequence


           _____________________273_______________________________________________________________________________355___________369 
 1slq(B) : ****IVVSKTSLWKEMQYNRDITIRFKFASSIVKSGGLGYKWSEISFKPANYQYTYTRDGEEVTAHTTCSVNGMNDFNFNGGSLPTDFVISRYEVIKENSYVYVDYWDDSQAFRNMVYVR 
         :                                                                                                                          
 2b4h(A) : ANEDIVVSKTSLWKEMQYNRDITIRFKFASSIVKSGGLGYKWSEISFKPANYQYTYTRDGEEVTAHTTCSVNGMNDFNFNGGSLPTDFVISRYEVIKENSYVYVDYWDDSQAFRNMVYVR 
           _____________________273_______________________________________________________________________________355___________369 

           ____________________________________408_______________426____________________________________465________________________ 
 1slq(B) : SLAANLNSVICTGGDYSFALPVGQWPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLTVEEPSFSITRTRVSRLYGLPAANPNNGKEYYEVAGRFSLISLVPSNDDYQTPITNSVT 
         :                                                                                                                          
 2b4h(A) : SLAANLNSVICTGGDYSFALPVGQWPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLTVEEPSFSITRTRVSRLYGLPAANPNNGKEYYEVAGRFSLISLVPS************* 
           ____________________________________408_______________426____________________________________465________________________ 

           _________________________________                                                                                        
 1slq(B) : VRQDLERQLGELREEFNALSQEIAMSQLIDLAL                                                                                        
         :                                                                                                                          
 2b4h(A) : *********************************                                                                                        
           _________________________________                                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		29.4
Translation
(A) 		0.1
Closure
(%) 		84.4
Bending Residues
( green ) 		  273 - 275
  355 - 356
  369 - 375
  408 - 409
  426 - 427
  465 - 466
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download