Xpf Endonuclease

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Xpf Endonuclease
  Conformer 1
(PDB) 		2bgw (A)
  Conformer 2
(PDB) 		2bhn (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 145 6.68   21 - 165
2 62 0.5   166 - 227

Sequence


           ________________________________________________________________________________________________________________________ 
 2bgw(A) : MLEDPGGRPRVYVDVREERSPVPSILESLGVQVIPKQLPMGDYLVSDSIIVERKTSSDFAKSLFDGRLFEQASRLAEHYETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIRLMNT 
         :                                                                                                                          
 2bhn(D) : ********PRVYVDVREERSPVPSILESLGVQVIPKQLPMGDYLVSDSIIVERKTSSDFAKSLFDGRLFEQASRLAEHYETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIRLMNT 
           ________________________________________________________________________________________________________________________ 

           _________________150_______________________________________________________________________________                      
 2bgw(A) : MDPKGTALVIESLARLSTREGGQRIVIHKKPRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMTPYK                      
         :                                                                                                                          
 2bhn(D) : MDPKGTALVIESLARLSTREGGQRIVIHKKPRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMTPYK                      
           _________________150_______________________________________________________________________________                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		89.2
Translation
(A) 		-1.3
Closure
(%) 		99.4
Bending Residues
( green ) 		  150 - 166
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download