Xpf Endonuclease

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Xpf Endonuclease
  Conformer 1
(PDB) 		2bhn (D)
  Conformer 2
(PDB) 		2bhn (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 132 0.63   21 - 152
2 75 0.37   153 - 227

Sequence


           ________________________________________________________________________________________________________________________ 
 2bhn(D) : PRVYVDVREERSPVPSILESLGVQVIPKQLPMGDYLVSDSIIVERKTSSDFAKSLFDGRLFEQASRLAEHYETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIRLMNTMDPKGTAL 
         :                                                                                                                          
 2bhn(A) : PRVYVDVREERSPVPSILESLGVQVIPKQLPMGDYLVSDSIIVERKTSSDFAKSLFDGRLFEQASRLAEHYETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIRLMNTMDPKGTAL 
           ________________________________________________________________________________________________________________________ 

           ________149________________________________________________________________________________                              
 2bhn(D) : VIESLARLSTREGGQRIVIHKKPRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMTPYK                              
         :                                                                                                                          
 2bhn(A) : VIESLARLSTREGGQRIVIHKKPRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMTPYK                              
           ________149________________________________________________________________________________                              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.2
Translation
(A) 		0.5
Closure
(%) 		36.0
Bending Residues
( green ) 		  149 - 153
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download