Putative phosphoglycolate phosphatase
Ligand-induced domain movement details

Jmol view of liganded conformation 2

Domain Movement

domain 1 is binding domain(fixed in space) domain 2 is binding domain(fixed in space)

Sequence


           __________________________________________________ 
 2hi0(A) : GkYKAAIFDdGTILDTSADLTSALNYAFEQTGHRHDFTVEDIKNFFGSGV 
         :                                                    
 2hi0(B) : *KYKAAIFDdGTILDTSADLTSALNYAFEQTGHRHDFTVEDIKNFFGSGV 
           __________________________________________________ 

           __________________________________________________ 
 2hi0(A) : VVAVTRALAYEAGSSRESLVAFGTKDEQIPEAVTQTEVNRVLEVFKPYYA 
         :                                                    
 2hi0(B) : VVAVTRALAYEAGSSRESLVAFGTKDEQIPEAVTQTEVNRVLEVFKPYYA 
           __________________________________________________ 

           __________________________131_________________151_ 
 2hi0(A) : DHCQIKTGPFPGILDLkNLRQKGVKLAVVSNKPNEAVQVLVEELFPGSFD 
         :                                                    
 2hi0(B) : DHCQIKTGPFPGILDLkNLRQKGVKLAVVSNKPNEAVQVLVEELFPGSFD 
           __________________________131_________________151_ 

           ________163_______________________________________ 
 2hi0(A) : FALGEKSGIRRKPAPDtSECVKVLGVPRDKCVYIGDSEIDIQTARNSEdE 
         :                                                    
 2hi0(B) : FALGEKSGIRRKPAPDtSECVKVLGVPRDKCVYIGDSEIDIQTARNSEdE 
           ________163_______________________________________ 

           ___________________________________                
 2hi0(A) : IAVNWGFRSVPFLQKHGATVIVDTAEKLEEAILGE                
         :                                                    
 2hi0(B) : IAVNWGFRSVPFLQKHGATVIVDTAEKLEEAILGE                
           ___________________________________                

Details

  Property   Value
 Conformer 1 2hi0(A)
 Conformer 2 2hi0(B)
 Radius gyration for conformer 1 17.36 A
 Radius gyration for conformer 2 17.64 A
 EC Number 3.1.3.18  
Click here to see the DynDom results or the famliy
 Trigger ligands EDO22
ACT10
 Trigger ligands in which conformation Conformation  2
 Conformaton with trigger ligands is compact No
 Spanning ligands Yes
 Residues in enzyme contacting ligands ASP152  LYS127 
 Residues in extended bending regions contacting ligands ASP152 
 Residues in extended bending regions making H-bonds or salt-bridges with ligands ASP152 
  Residues in extended bending regions with an H-bond between its main chain and ligands Null
Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT