GLUTATHIONE S-TRANSFERASE
Ligand-induced domain movement details

Jmol view of liganded conformation 1

Domain Movement

domain 1 is binding domain(fixed in space) domain 2 is binding domain(fixed in space)

Sequence


           ____________________________30___________43_______ 
 1xw5(B) : PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKF 
         :                                                    
 1hnb(A) : PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKF 
           ____________________________30___________43_______ 

           __________________________________________________ 
 1xw5(B) : KLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILE 
         :                                                    
 1hnb(A) : KLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILE 
           __________________________________________________ 

           __________________________________________________ 
 1xw5(B) : NQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGD 
         :                                                    
 1hnb(A) : NQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGD 
           __________________________________________________ 

           ____________________________________________197___ 
 1xw5(B) : KITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSS 
         :                                                    
 1hnb(A) : KITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSS 
           ____________________________________________197___ 

           _________________                                  
 1xw5(B) : RFLPRPVFTKMAVWGNK                                  
         :                                                    
 1hnb(A) : RFLPRPVFTKMAVFGNK                                  
           _________________                                  

Details

  Property   Value
 Conformer 1 1xw5(B)
 Conformer 2 1hnb(A)
 Radius gyration for conformer 1 17.46 A
 Radius gyration for conformer 2 17.7 A
 EC Number 2.5.1.18  
Click here to see the DynDom results or the famliy
 Trigger ligands GSH472
 Trigger ligands in which conformation Conformation  1
 Conformaton with trigger ligands is compact Yes
 Spanning ligands Yes
 Residues in enzyme contacting ligands ARG42  ASN58  GLN71  LEU12  LEU59  LYS49  PRO60  SER72  TRP45  TRP7  TYR6 
 Residues in extended bending regions contacting ligands ARG42  LYS49  TRP45 
 Residues in extended bending regions making H-bonds or salt-bridges with ligands ARG42  LYS49  TRP45 
  Residues in extended bending regions with an H-bond between its main chain and ligands Null
Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT