Guanylate kinase
Ligand-induced domain movement details

Jmol view of liganded conformation 1

Domain Movement

domain 1 is binding domain(fixed in space) domain 2 is binding domain(fixed in space)

Sequence


           _______________________________34_________________ 
 2anb(A) : AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHG 
         :                                                    
 2f3t(C) : AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHG 
           _______________________________34_________________ 

           _________________________________86_______________ 
 2anb(A) : EHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFL 
         :                                                    
 2f3t(C) : EHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFL 
           _________________________________86_______________ 

           __________________________________________________ 
 2anb(A) : DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMA 
         :                                                    
 2f3t(C) : DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLR----dSEEVIAKRMA 
           __________________________________________________ 

           __________________________________________________ 
 2anb(A) : QAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALI 
         :                                                    
 2f3t(C) : QAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALI 
           __________________________________________________ 

           ______                                             
 2anb(A) : SKLLAD                                             
         :                                                    
 2f3t(C) : SKLLA*                                             
           ______                                             

Details

  Property   Value
 Conformer 1 2anb(A)
 Conformer 2 2f3t(C)
 Radius gyration for conformer 1 18.1 A
 Radius gyration for conformer 2 18.95 A
 EC Number 2.7.4.8  
Click here to see the DynDom results or the famliy
 Trigger ligands 5GP301
 Trigger ligands in which conformation Conformation  1
 Conformaton with trigger ligands is compact Yes
 Spanning ligands Yes
 Residues in enzyme contacting ligands ALA11  ALA75  ARG149  ARG42  ARG45  ASP102  ASP104  GLU73  GLY107  GLY83  ILE103  LYS17  PHE78  SER38  THR84  TYR54  TYR82  VAL77 
 Residues in extended bending regions contacting ligands GLY83  SER38  THR84 
 Residues in extended bending regions making H-bonds or salt-bridges with ligands SER38  THR84 
  Residues in extended bending regions with an H-bond between its main chain and ligands Null
Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT